Structure of PDB 6j3z Chain d

Receptor sequence

>6j3zd (length=341)

RGLFDLVDDWLKKDRFVFVGWSGLLLFPTAYLAAGGWMTGTTFVTSWYTH
GLASSYLEGCNFLTAAVSTPANSVGHSLLLLWGPEAQGDFTRWCQIGGLW
TFVALHGAFGLIGFCLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLLYP
LGQASWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLC
AIHGATVENTLFEDGDAANTFRAFTPTQSEETYSMVTANRFWSQIFGVAF
SNKRWLHFFMLFVPVTGLWTSSIGIVGLALNLRAYDFVSQELRAAEDPEF
ETFYTKNHLLDEGIRAWMAAQDQPHENFVFPEEVLPRGNAL

3D structure

• PDB: 6j3z Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.
• Chain: d
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	d	Y41 F53 Y66 L67	Y31 F43 Y56 L57
BS02	FE2	d	H213 H267	H203 H257
BS03	BCT	d	H213 H267	H203 H257
BS04	CLA	d	F119 I122 C125 L126	F109 I112 C115 L116
BS05	CLA	d	V200 A201	V190 A191
BS06	CLA	d	F156 I177 F178 L181	F146 I167 F168 L171
BS07	PHO	d	I212 W252	I202 W242
BS08	PHO	d	A40 W47 F124 Q128 N141 F145 P148 F172 L278	A30 W37 F114 Q118 N131 F135 P138 F162 L268
BS09	CLA	d	P148 V151 L181 L184 Q185 W190 H196 G199 V200 S281	P138 V141 L171 L174 Q175 W180 H186 G189 V190 S271
BS10	CLA	d	T39 L42 L90 L91 W92 F112 H116 F119	T29 L32 L80 L81 W82 F102 H106 F109

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 03:59:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6j3z', asym_id = 'd', title = 'Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6j3z', asym_id='d', title='Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009523,0009772,0015979,0016020,0019684,0045156', uniprot = '', pdbid = '6j3z', asym_id = 'd'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009523,0009772,0015979,0016020,0019684,0045156', uniprot='', pdbid='6j3z', asym_id='d')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>