Structure of PDB 6g90 Chain d

Receptor sequence

>6g90d (length=93) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEP
QGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPI

3D structure

PDB

6g90 Prespliceosome structure provides insights into spliceosome assembly and regulation.

Chain

Resolution

4.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d	S39 N41 R65 P93	S37 N39 R63 P91

Gene Ontology

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000387	spliceosomal snRNP assembly
GO:0000395	mRNA 5'-splice site recognition
GO:0000398	mRNA splicing, via spliceosome
GO:0006396	RNA processing
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0036261	7-methylguanosine cap hypermethylation
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0000243	commitment complex
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0005687	U4 snRNP
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0034715	pICln-Sm protein complex
GO:0034719	SMN-Sm protein complex
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071001	U4/U6 snRNP
GO:0071004	U2-type prespliceosome
GO:0071011	precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome
GO:0097525	spliceosomal snRNP complex
GO:0097526	spliceosomal tri-snRNP complex
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6g90, PDBe:6g90, PDBj:6g90
PDBsum	6g90
PubMed	29995849
UniProt	P43321\|SMD3_YEAST Small nuclear ribonucleoprotein Sm D3 (Gene Name=SMD3)