Structure of PDB 6fyy Chain d

Receptor sequence
>6fyyd (length=55) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]
AHENVWYSHPRKFGKGSRQCRISGSHSGLIRKYGLNIDRQSFREKANDIG
FYKYR
3D structure
PDB6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
Chaind
Resolution3.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d A2 H3 V6 W7 Y8 H10 R12 F14 G15 K16 G17 R19 S24 S26 G29 L30 I31 R32 K33 Y34 R40 Q41 S42 R44 E45 K54 Y55 R56 A1 H2 V5 W6 Y7 H9 R11 F13 G14 K15 G16 R18 S23 S25 G28 L29 I30 R31 K32 Y33 R39 Q40 S41 R43 E44 K53 Y54 R55
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fyy, PDBe:6fyy, PDBj:6fyy
PDBsum6fyy
PubMed30475211
UniProtQ6CPG3|RS29_KLULA Small ribosomal subunit protein uS14 (Gene Name=RPS29)

[Back to BioLiP]