Structure of PDB 6fai Chain d

Receptor sequence
>6faid (length=37) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
QCRVCSSHTGLIRKYGLNICRQCFREKANDIGFNKFR
3D structure
PDB6fai Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
Chaind
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d T28 G29 I31 R32 K33 E45 F55 R56 T9 G10 I12 R13 K14 E26 F36 R37
BS02 ZN d C21 C24 C42 C2 C5 C23
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fai, PDBe:6fai, PDBj:6fai
PDBsum6fai
PubMed29459436
UniProtP41057|RS29A_YEAST Small ribosomal subunit protein uS14A (Gene Name=RPS29A)

[Back to BioLiP]