Structure of PDB 5xy3 Chain d

Receptor sequence
>5xy3d (length=99) Species: 5722 (Trichomonas vaginalis) [Search protein sequence]
LAPAKIETTIHLQKAVHGTTRRFRAERAIKVIAAAAKKMMHTDVVKIDPE
LNSRIWIHGKNPPTRVRVTFERKADEKMITIASFKNVASFNGLQTTKVV
3D structure
PDB5xy3 Cryo-EM structures of the 80S ribosomes from human parasites Trichomonas vaginalis and Toxoplasma gondii
Chaind
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d T13 H15 Q17 K18 H21 T24 R25 R26 R28 E30 R31 K34 H45 K50 I51 N56 S57 W60 H62 K64 R70 N100 G101 L102 Q103 T104 T9 H11 Q13 K14 H17 T20 R21 R22 R24 E26 R27 K30 H41 K46 I47 N52 S53 W56 H58 K60 R65 N91 G92 L93 Q94 T95
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xy3, PDBe:5xy3, PDBj:5xy3
PDBsum5xy3
PubMed28809395
UniProtA2D9N8

[Back to BioLiP]