Structure of PDB 5xnl Chain d

Receptor sequence

>5xnld (length=341) Species: 3888 (Pisum sativum) [Search protein sequence]

NDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFAVGGWFTGTTFVTSWYTH
GLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDLTRWCQLGGLW
TFVALHGAFGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYP
LGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLC
AIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAF
SNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEF
ETFYTKNILLNEGIRAWMATQDQPHENLIFPEEVLPRGNAL

3D structure

PDB

5xnl Structure and assembly mechanism of plant C2S2M2-type PSII-LHCII supercomplex

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE2	d	H215 H269	H203 H257
BS02	CLA	d	M199 V202 A203 L206 G207	M187 V190 A191 L194 G195
BS03	CLA	d	F158 V176 I179 F180 I183	F146 V164 I167 F168 I171
BS04	PHO	d	L206 A209 L210 I214 W254 F258	L194 A197 L198 I202 W242 F246
BS05	PHO	d	A42 A45 V46 W49 G122 L123 F126 Q130 N143 A146 F147 P150 F154 G175 P276 L280	A30 A33 V34 W37 G110 L111 F114 Q118 N131 A134 F135 P138 F142 G163 P264 L268
BS06	CLA	d	M200 M282	M188 M270
BS07	CLA	d	L37 F121 I124 M127 L128	L25 F109 I112 M115 L116
BS08	BCT	d	H215 Y245 H269	H203 Y233 H257
BS09	CLA	d	P150 V153 V157 F182 I183 F186 Q187 W192 T193 H198 G201 V202 V205 L206 S283 A284	P138 V141 V145 F170 I171 F174 Q175 W180 T181 H186 G189 V190 V193 L194 S271 A272
BS10	CLA	d	L37 C41 F44 L90 L91 L92 L93 W94 W105 T113 F114 H118 F121	L25 C29 F32 L78 L79 L80 L81 W82 W93 T101 F102 H106 F109

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5xnl, PDBe:5xnl, PDBj:5xnl
PDBsum	5xnl
PubMed	28839073
UniProt	P06006\|PSBD_PEA Photosystem II D2 protein (Gene Name=psbD)

[Back to BioLiP]