Structure of PDB 5ws5 Chain d

Receptor sequence

>5ws5d (length=341) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]

RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTH
GLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLW
TFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYP
LGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLC
AIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAF
SNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEF
ETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

3D structure

PDB

5ws5 Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.

Chain

Resolution

2.35 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	d	H214 H268	H203 H257
BS02	BCT	d	H214 Y244 H268	H203 Y233 H257
BS03	CLA	d	L182 F257	L171 F246
BS04	CLA	d	M198 V201 A202	M187 V190 A191
BS05	CLA	d	F157 I178 L182	F146 I167 L171
BS06	PHO	d	L205 A208 L209 I213 W253 F257	L194 A197 L198 I202 W242 F246
BS07	PHO	d	A41 W48 G121 L122 F125 Q129 N142 F146 P149 V175 P275 L279	A30 W37 G110 L111 F114 Q118 N131 F135 P138 V164 P264 L268
BS08	CLA	d	F120 I123 M126 L127	F109 I112 M115 L116
BS09	CLA	d	P149 V152 V156 F181 L182 F185 Q186 W191 T192 H197 G200 V201 V204 L205 S282 A283	P138 V141 V145 F170 L171 F174 Q175 W180 T181 H186 G189 V190 V193 L194 S271 A272
BS10	CLA	d	P39 C40 L43 L91 L92 W93 T112 F113 H117	P28 C29 L32 L80 L81 W82 T101 F102 H106

Gene Ontology

	Molecular Function
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5ws5, PDBe:5ws5, PDBj:5ws5
PDBsum	5ws5
PubMed	28219079
UniProt	D0VWR8\|PSBD_THEVL Photosystem II D2 protein (Fragment) (Gene Name=psbD)

[Back to BioLiP]