Structure of PDB 5tis Chain d

Receptor sequence

>5tisd (length=341) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTH
GLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLW
TFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYP
LGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLC
AIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAF
SNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEF
ETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

3D structure

PDB

5tis Structure of photosystem II and substrate binding at room temperature.

Chain

Resolution

2.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	d	H214 H268	H203 H257
BS02	BCT	d	H214 H268	H203 H257
BS03	CLA	d	I178 L182	I167 L171
BS04	PHO	d	L205 L209 I213 W253 F257	L194 L198 I202 W242 F246
BS05	PHO	d	A41 L45 W48 G121 L122 F125 N142 F146 P149 F173 L279	A30 L34 W37 G110 L111 F114 N131 F135 P138 F162 L268
BS06	CLA	d	M198 V201 A202	M187 V190 A191
BS07	CLA	d	F120 I123 M126 L127	F109 I112 M115 L116
BS08	CLA	d	P149 V152 V156 F181 L182 F185 Q186 W191 T192 H197 G200 V201 S282 A283 V286	P138 V141 V145 F170 L171 F174 Q175 W180 T181 H186 G189 V190 S271 A272 V275
BS09	CLA	d	C40 L43 L90 L91 L92 W93 F113 H117	C29 L32 L79 L80 L81 W82 F102 H106

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5tis, PDBe:5tis, PDBj:5tis
PDBsum	5tis
PubMed	27871088
UniProt	Q8CM25\|PSBD_THEVB Photosystem II D2 protein (Gene Name=psbD1)

[Back to BioLiP]