Structure of PDB 5t2a Chain d

Receptor sequence

>5t2ad (length=399) Species: 5661 (Leishmania donovani)

SHCKFEHPRHGHLGFLPRKRSRQIRGRARAFPKDDATQKPHLTSFMVFKA
GMTHIVRDVDRPGSKVNKKEVVEPVTILEAPPMVIVGIVGYRQTPVGLKT
IGTVWAHHTSVEFRRRYYKNWKQSAQLAFSRQKQFANTKEGKVAEARTLN
AFAKKASVIRVIAHTQLRKLRNHRVGVKKAHVQEIQVNGGSVAAKIALAK
SLLEKEVRVDSVFQQSEACDVCSVTKGHGTEGVVKRWGVACLPRKTHRGL
RKVACIGAWHPARVMYTVARAGQHGYHHRTQLNKKIYQIGRSVAVEPNQA
TTTYDLTAKTITPMGGFVGYGTVRNDYVMLKGSVSGPRRRVMTLRRPMAP
QTSRQLKEKIVLKFIDTSSKIGHGRFQTKKEKNQWFGPLKKDRIRREER

3D structure

• PDB: 5t2a Structures and stabilization of kinetoplastid-specific split rRNAs revealed by comparing leishmanial and human ribosomes.
• Chain: d
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d	K246 H248	K245 H247
BS02	rna	d	S2 H3 C4 K5 F6 E7 H8 P9 R10 H11 R19 K20 R21 R93 P96 V97 H109 N138 T139 R148 N151 K155 R169 K170 R172 E207 T231 G233 K236 R237 V240 A241 C242 R245 K246 T247 H248 R249 G250 R252 K253 V254 A255 C256 G258 A259 W260 H261 A263 R264 V265 M266 T268 R271 A272 Q274 A295 R325	S1 H2 C3 K4 F5 E6 H7 P8 R9 H10 R18 K19 R20 R92 P95 V96 H108 N137 T138 R147 N150 K154 R168 K169 R171 E206 T230 G232 K235 R236 V239 A240 C241 R244 K245 T246 H247 R248 G249 R251 K252 V253 A254 C255 G257 A258 W259 H260 A262 R263 V264 M265 T267 R270 A271 Q273 A294 R324
BS03	rna	d	P9 H11 G12 H13 L14 G15 F16 P18 K20 R26 R30 M53 H55 R62 G64 S65 P75 Y92 G98 L99 T101 I102 G103 T104 W106 Y118 L128 F130 R132 R161 E185 T226 K227 Y267 H279 R280 T281 L283 N284 K285 K332 G333 S334 V335 S336 M349 P351 R355 K371 G373	P8 H10 G11 H12 L13 G14 F15 P17 K19 R25 R29 M52 H54 R61 G63 S64 P74 Y91 G97 L98 T100 I101 G102 T103 W105 Y117 L127 F129 R131 R160 E184 T225 K226 Y266 H278 R279 T280 L282 N283 K284 K331 G332 S333 V334 S335 M348 P350 R354 K370 G372
BS04	rna	d	R21 Y119 K120 N121 K123 Q124 S125 A126 H174 R175 V176 G177 V178 K179 K180 K227 G228 G230 T231 G316 G320 G322 R340 R341 S370 I372 K380 K383 W386 F387 L390 K391 K392	R20 Y118 K119 N120 K122 Q123 S124 A125 H173 R174 V175 G176 V177 K178 K179 K226 G227 G229 T230 G315 G319 G321 R339 R340 S369 I371 K379 K382 W385 F386 L389 K390 K391

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Feb 26 21:57:44 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5t2a', asym_id = 'd', title = 'Structures and stabilization of kinetoplastid-sp...led by comparing leishmanial and human ribosomes.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5t2a', asym_id='d', title='Structures and stabilization of kinetoplastid-sp...led by comparing leishmanial and human ribosomes.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '5t2a', asym_id = 'd'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='5t2a', asym_id='d')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>