Structure of PDB 5njt Chain d

Receptor sequence
>5njtd (length=122) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPGG
VVKKGEVVKAVIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFG
PVARELRENNFMKIVSLAPEVI
3D structure
PDB5njt Structure of the Bacillus subtilis hibernating 100S ribosome reveals the basis for 70S dimerization.
Chaind
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d P48 K54 R97 P48 K54 R97
BS02 rna d M1 Q3 Q4 T6 R7 I22 K23 L25 G27 S28 R30 K31 V40 K44 R70 Y76 M1 Q3 Q4 T6 R7 I22 K23 L25 G27 S28 R30 K31 V40 K44 R70 Y76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5njt, PDBe:5njt, PDBj:5njt
PDBsum5njt
PubMed28468753
UniProtP12875|RL14_BACSU Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]