Structure of PDB 5lj5 Chain d |
>5lj5d (length=82) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQ GAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK |
|
PDB | 5lj5 Cryo-EM structure of the spliceosome immediately after branching. |
Chain | d |
Resolution | 10.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
d |
N41 R65 S67 |
N38 R62 S64 |
|
|
|
|