Structure of PDB 5imq Chain d

Receptor sequence

>5imqd (length=182) Species: 300852 (Thermus thermophilus HB8)

MPLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDA
RILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMW
IFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVD
ALRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
• Chain: d
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d	F80 K81 L82 R83 K84	F80 K81 L82 R83 K84
BS02	rna	d	K36 V38 N40 E45 I77 K81 R83 M86 R91 F125 Y131 G134 L135 R136 R153 G154 M155 D156 V160	K36 V38 N40 E45 I77 K81 R83 M86 R91 F125 Y131 G134 L135 R136 R153 G154 M155 D156 V160
BS03	rna	d	Q26 W29 E30 G65 Q66 G89 V92 T93 L94 R95 R96 R98	Q26 W29 E30 G65 Q66 G89 V92 T93 L94 R95 R96 R98

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5imq, PDBe:5imq, PDBj:5imq
• PDBsum: 5imq
• PubMed: 27137929
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)