Structure of PDB 4tnj Chain d

Receptor sequence

>4tnjd (length=340) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHG
LASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWT
FIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPL
GQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCA
IHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFS
NKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFE
TFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

3D structure

PDB

4tnj Taking snapshots of photosynthetic water oxidation using femtosecond X-ray diffraction and spectroscopy.

Chain

Resolution

4.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	d	H214 H268	H202 H256
BS02	CLA	d	M198 V201	M186 V189
BS03	CLA	d	F157 I178 L182	F145 I166 L170
BS04	PHO	d	A41 W48 F125 F146 P149 F153 F173 P275 L279	A29 W36 F113 F134 P137 F141 F161 P263 L267
BS05	CLA	d	F120 I123 M126 L127 F130	F108 I111 M114 L115 F118
BS06	PHO	d	L205 L209 I213 W253 F257	L193 L197 I201 W241 F245
BS07	BCT	d	Y244 K264 H268	Y232 K252 H256
BS08	CLA	d	W48 V152 F153 V156 F181 L182 F185 Q186 W191 T192 H197 G200 V201 L279 S282 A283 V286	W36 V140 F141 V144 F169 L170 F173 Q174 W179 T180 H185 G188 V189 L267 S270 A271 V274
BS09	CLA	d	L43 L92 W93 T112 F113 H117	L31 L80 W81 T100 F101 H105

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4tnj, PDBe:4tnj, PDBj:4tnj
PDBsum	4tnj
PubMed	25006873
UniProt	Q8CM25\|PSBD_THEVB Photosystem II D2 protein (Gene Name=psbD1)

[Back to BioLiP]