Structure of PDB 3jcu Chain d

Receptor sequence

>3jcud (length=340) Species: 3562 (Spinacia oleracea) [Search protein sequence]

KDLFDSMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTH
GLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLW
AFVALHGAFALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYP
LGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLC
AIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAF
SNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEF
ETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNA

3D structure

PDB

3jcu Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	d	H214 H268	H203 H257
BS02	CLA	d	M198 V201	M187 V190
BS03	CLA	d	V175 I178 F179 I182	V164 I167 F168 I171
BS04	PHO	d	L205 A208 L209 I213 W253 F257	L194 A197 L198 I202 W242 F246
BS05	PHO	d	A41 W48 A121 F125 Q129 N142 A145 F146 P149 F153 F173 G174 P275 V276 L279	A30 W37 A110 F114 Q118 N131 A134 F135 P138 F142 F162 G163 P264 V265 L268
BS06	CLA	d	F120 I123 M126 L127	F109 I112 M115 L116
BS07	BCT	d	H214 Y244 H268	H203 Y233 H257
BS08	CLA	d	P149 V152 V156 F181 I182 F185 Q186 W191 T192 H197 G200 V204 S282 A283 V286	P138 V141 V145 F170 I171 F174 Q175 W180 T181 H186 G189 V193 S271 A272 V275
BS09	CLA	d	P39 C40 F43 L90 L91 L92 W93 A112 F113 L116 H117 F120	P28 C29 F32 L79 L80 L81 W82 A101 F102 L105 H106 F109

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jcu, PDBe:3jcu, PDBj:3jcu
PDBsum	3jcu
PubMed	27251276
UniProt	P06005\|PSBD_SPIOL Photosystem II D2 protein (Gene Name=psbD)

[Back to BioLiP]