Structure of PDB 3jap Chain d

Receptor sequence
>3japd (length=53) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]
ENVWYSHPRKFGKGSRQCRISGSHSGLIRKYGLNIDRQSFREKANDIGFY
KYR
3D structure
PDB3jap Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
Chaind
Resolution4.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d W7 Y8 H10 P11 F14 K16 G17 R19 H27 G29 I31 R32 K33 Y34 R40 Q41 E45 K54 Y55 R56 W4 Y5 H7 P8 F11 K13 G14 R16 H24 G26 I28 R29 K30 Y31 R37 Q38 E42 K51 Y52 R53
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jap, PDBe:3jap, PDBj:3jap
PDBsum3jap
PubMed26212456
UniProtQ6CPG3|RS29_KLULA Small ribosomal subunit protein uS14 (Gene Name=RPS29)

[Back to BioLiP]