Structure of PDB 3jam Chain d

Receptor sequence
>3jamd (length=53) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]
ENVWYSHPRKFGKGSRQCRISGSHSGLIRKYGLNIDRQSFREKANDIGFY
KYR
3D structure
PDB3jam Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
Chaind
Resolution3.46 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna d N5 V6 W7 Y8 S9 H10 R12 F14 G15 K16 G17 R19 S24 S26 L30 I31 R32 K33 Y34 R40 Q41 S42 R44 K54 Y55 R56 N2 V3 W4 Y5 S6 H7 R9 F11 G12 K13 G14 R16 S21 S23 L27 I28 R29 K30 Y31 R37 Q38 S39 R41 K51 Y52 R53
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3jam, PDBe:3jam, PDBj:3jam
PDBsum3jam
PubMed26212456
UniProtQ6CPG3|RS29_KLULA Small ribosomal subunit protein uS14 (Gene Name=RPS29)

[Back to BioLiP]