Structure of PDB 3j6b Chain d

Receptor sequence
>3j6bd (length=204) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KVNHSISRFRPASWFEKTKIIPPQVYIFRNLEYGQVLYSQFPNFSQTQVD
KLFVRPNWSNRKPSLRRDIWKCMCVVNLQNYKQSVHLYQNLCRLRYLRDV
AQRKESDKLRKKDSNGHVWYSGQYRPTYCQEAVADLRESLLKVFENAAKK
PSIYWEDPWRMGDKDKHWNYDVFNALGLEHKLIQRVGNIAREESVILKEL
AKLE
3D structure
PDB3j6b Structure of the yeast mitochondrial large ribosomal subunit.
Chaind
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d V3 N4 H5 S6 R9 F10 R11 W15 T19 L32 N44 R56 P57 N58 W59 R62 R67 R68 D69 R94 Y97 N116 H118 Y121 G123 Q124 R126 R201 K208 V2 N3 H4 S5 R8 F9 R10 W14 T18 L31 N43 R55 P56 N57 W58 R61 R66 R67 D68 R93 Y96 N115 H117 Y120 G122 Q123 R125 R191 K198
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000002 mitochondrial genome maintenance
GO:0006310 DNA recombination
GO:0006355 regulation of DNA-templated transcription
GO:0032543 mitochondrial translation
GO:0034599 cellular response to oxidative stress
GO:0090297 positive regulation of mitochondrial DNA replication
Cellular Component
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum3j6b
PubMed24675956
UniProtQ06630|MHR1_YEAST Large ribosomal subunit protein mL67 (Gene Name=MHR1)

[Back to BioLiP]