Structure of PDB 2axt Chain d

Receptor sequence

>2axtd (length=340) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHG
LASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWT
FIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPL
GQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCA
IHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFS
NKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFE
TFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

3D structure

PDB

2axt Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	d	H5214 H5268	H202 H256
BS02	CLA	d	M5198 V5201 A5202 G5206	M186 V189 A190 G194
BS03	PHO	d	L5205 A5208 L5209 I5213 W5253 F5257	L193 A196 L197 I201 W241 F245
BS04	PHO	d	A5041 L5045 W5048 G5118 L5122 F5125 Q5129 N5142 F5146 P5149 F5153 G5174 L5279	A29 L33 W36 G106 L110 F113 Q117 N130 F134 P137 F141 G162 L267
BS05	CLA	d	F5120 I5123 M5126 L5127 F5130	F108 I111 M114 L115 F118
BS06	BCT	d	H5214 Y5244 H5268	H202 Y232 H256
BS07	CLA	d	V5152 V5156 F5181 L5182 F5185 Q5186 W5191 T5192 H5197 G5200 V5201 V5204 L5279 S5282 A5283 V5286	V140 V144 F169 L170 F173 Q174 W179 T180 H185 G188 V189 V192 L267 S270 A271 V274
BS08	CLA	d	L5043 L5090 L5091 L5092 W5093 F5113 H5117 F5120	L31 L78 L79 L80 W81 F101 H105 F108

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2axt, PDBe:2axt, PDBj:2axt
PDBsum	2axt
PubMed	16355230
UniProt	Q8CM25\|PSBD_THEVB Photosystem II D2 protein (Gene Name=psbD1)

[Back to BioLiP]