Structure of PDB 7nwi Chain cc

Receptor sequence
>7nwicc (length=61) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
PIKLARVTKVIGKTGSQGQCTQVRVEFMDDTSHSTIRNVKGPVREGDVLT
LLESEREARRL
3D structure
PDB7nwi Blasticidin S inhibits mammalian translation and enhances production of protein encoded by nonsense mRNA.
Chaincc
Resolution3.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna cc S23 Q24 G25 P49 S16 Q17 G18 P42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nwi, PDBe:7nwi, PDBj:7nwi
PDBsum7nwi
PubMed34157102
UniProtG1TIB4|RS28_RABIT Small ribosomal subunit protein eS28 (Gene Name=RPS28)

[Back to BioLiP]