Structure of PDB 5y6p Chain cb

Receptor sequence

>5y6pcb (length=172) Species: 35689 (Griffithsia pacifica)

MLDAFAKVVAQADARGEFLSNKQLNSLETMIGEGNKRLDIVNKINSNAST
IVTNSARALFAEQPQLIQPGGNAYTSRRMAACLRDMEIVLRYVSYAMTAG
DSSVLDDRCLNGLRETYQALGTPGTSVAVAIQKMKEASIALANDLNGVPL
GDCSSLNSELAVYFDRAAAAVV

3D structure

• PDB: 5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
• Chain: cb
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	cb	N72 A73 R78 A81 C82 D85 L113 Y117 L120 T122 V127	N72 A73 R78 A81 C82 D85 L113 Y117 L120 T122 V127
BS02	PEB	cb	D39 I40 N42 V148 P149 G151 C153	D39 I40 N42 V148 P149 G151 C153

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 14:46:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'cb', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='cb', title='Structure of phycobilisome from the red alga Griffithsia pacifica')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'cb'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='cb')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>