Structure of PDB 8ipb Chain ca

Receptor sequence

>8ipbca (length=178) Species: 4565 (Triticum aestivum) [Search protein sequence]

GISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRG
GNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNA
IVQVDAAPFKQWYLTHSNNVQRKLEKRQQGRTLDSHIEEQFSGGRLLACI
SSRPGQCGRADGYILEGKELEFYMRKLQ

3D structure

PDB

8ipb Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	ca	G2 I3 R5 D6 H9 K10 R11 R12 A13 T14 K19 W21 R22 K23 K24 R25 Y27 G30 R31 Q32 K42 R45 R48 V49 R50 G51 K55 R57 R60 N65 S67 T74 R75 K76 S87 V98 K99 N100 S155 N156 N157 R160 R165 S189 R191 G193 Q194 R197 D199	G1 I2 R4 D5 H8 K9 R10 R11 A12 T13 K18 W20 R21 K22 K23 R24 Y26 G29 R30 Q31 K41 R44 R47 V48 R49 G50 K54 R56 R59 N64 S66 T73 R74 K75 S86 V97 K98 N99 S117 N118 N119 R122 R127 S151 R153 G155 Q156 R159 D161
BS02	rna	ca	L80 E90 R93 R183	L79 E89 R92 R145

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ipb, PDBe:8ipb, PDBj:8ipb
PDBsum	8ipb
PubMed	38267667
UniProt	A0A3B6AYT7

[Back to BioLiP]