Structure of PDB 6kmx Chain cM

Receptor sequence
>6kmxcM (length=31) Species: 1641165 (Halomicronema hongdechloris C2206) [Search protein sequence]
MTLSETQVFVALVIALVPAILAFRLSTELYK
3D structure
PDB6kmx Structural basis for the adaptation and function of chlorophyll f in photosystem I.
ChaincM
Resolution2.41 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CLA cM S26 L29 Y30 S26 L29 Y30
BS02 CLA cM A11 L12 A11 L12
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 07:32:36 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6kmx', asym_id = 'cM', title = 'Structural basis for the adaptation and function of chlorophyll f in photosystem I.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6kmx', asym_id='cM', title='Structural basis for the adaptation and function of chlorophyll f in photosystem I.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979', uniprot = '', pdbid = '6kmx', asym_id = 'cM'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979', uniprot='', pdbid='6kmx', asym_id='cM')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>