Structure of PDB 7y5e Chain cL

Receptor sequence

>7y5ecL (length=452) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

SAAGRDIESTGFAWWSGNARLINVSGKLLGAHVAHAGIMVFWCGAMTLFE
VAHFIPEKPLYEQGFILLPHLATLGWGVGPGGEIVDTYPYFVVGVLHLIS
SAVLGFGGIYHSIIGPDTLEESFPFFGYDWRDKNKMTTILGIHLILLGLG
SFLLVAKAMFFGGIYDTWAPGGGDVRYVTNPTLNPAVIFGYVLKSPFGGD
GWVVSINNQEDLVGGHVWVGVICIAGGIWHILTKPFAWARRAFVWSGEAY
LSYSLAALALMGFTASCYAWYNNTAYPSEFYGPTGPEASQAQAFTFLVRD
QRLGANVASAQGPTGLGKYLMRSPSGEIIFGGETMRFWDLRAPWLEPLRG
PNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNYVS
PRSWLTSSHFFLPFFLFIGHLWHAGRARAAAAGFEKGINRENEPVLFMRP
LD

3D structure

PDB

7y5e In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	OEX	cL	E354 R357	E333 R336
BS02	CLA	cL	L95 S172 L175 L233 H237 L281 M282 T285 A286 Y289 A296 Y297	L74 S151 L154 L212 H216 L260 M261 T264 A265 Y268 A275 Y276
BS03	CLA	cL	W63 H91 L279 M282 A286 Y297 L426 H430 L433 P434 L437	W42 H70 L258 M261 A265 Y276 L405 H409 L412 P413 L416
BS04	CLA	cL	M60 V61 C64 L88 L92 W97 H118	M39 V40 C43 L67 L71 W76 H97
BS05	CLA	cL	W63 M67 F70 I87 W425 S429 F432	W42 M46 F49 I66 W404 S408 F411
BS06	CLA	cL	Y274 A277 F438 H441 A445	Y253 A256 F417 H420 A424
BS07	CLA	cL	L165 W223 I243 G247 W250 H251 F257 W259 F264	L144 W202 I222 G226 W229 H230 F236 W238 F243
BS08	CLA	cL	M157 T158 I160 L161 H164 L168 F264 Y271 Y274 S275 A278 M282	M136 T137 I139 L140 H143 L147 F243 Y250 Y253 S254 A257 M261
BS09	CLA	cL	W36 S37 N39 A40 L272 L276 F436 L437 G440 W443 H444	W15 S16 N18 A19 L251 L255 F415 L416 G419 W422 H423
BS10	CLA	cL	N39 L49 H53 H56 M60 L168 G268 Y271 L272 S275	N18 L28 H32 H35 M39 L147 G247 Y250 L251 S254
BS11	CLA	cL	N39 I59 M60 W63	N18 I38 M39 W42
BS12	CLA	cL	R26 G38 R41 L42 A52 S133	R5 G17 R20 L21 A31 S112
BS13	CLA	cL	H53 F147 I160 I163 H164 L167	H32 F126 I139 I142 H143 L146
BS14	CLA	cL	L50 V124 G128 Y131 H132 F144 F147	L29 V103 G107 Y110 H111 F123 F126

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009767	photosynthetic electron transport chain
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005737	cytoplasm
GO:0009507	chloroplast
GO:0009521	photosystem
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7y5e, PDBe:7y5e, PDBj:7y5e
PDBsum	7y5e
PubMed	36922595
UniProt	W0RYK4

[Back to BioLiP]