Structure of PDB 7dr2 Chain cK

Receptor sequence

>7dr2cK (length=69) Species: 2762 (Cyanophora paradoxa)

TQSVGEAAEKSFVMLASVLFAGAVGGPGIKMKGQGPAWPFNAQIPFTPSE
FLAVTALGHIIGTGVILGI

3D structure

• PDB: 7dr2 Structural insights into an evolutionary turning-point of photosystem I from prokaryotes to eukaryotes
• Chain: cK
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	cK	P125 F126	P39 F40
BS02	CLA	cK	I146 L153	I60 L67
BS03	CLA	cK	V110 G114 K116	V24 G28 K30
BS04	CLA	cK	S97 L101 H145	S11 L15 H59
BS05	CLA	cK	I146 I147 G150 G154	I60 I61 G64 G68
BS06	CLA	cK	V90 A94 S97 F98	V4 A8 S11 F12

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 09:46:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7dr2', asym_id = 'cK', title = 'Structural insights into an evolutionary turning...t of photosystem I from prokaryotes to eukaryotes'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7dr2', asym_id='cK', title='Structural insights into an evolutionary turning...t of photosystem I from prokaryotes to eukaryotes')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009522,0015979,0016020,0042651', uniprot = '', pdbid = '7dr2', asym_id = 'cK'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0015979,0016020,0042651', uniprot='', pdbid='7dr2', asym_id='cK')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>