Structure of PDB 7dr2 Chain cJ

Receptor sequence
>7dr2cJ (length=37) Species: 2762 (Cyanophora paradoxa) [Search protein sequence]
FSKYLSTAPVIGTLTAFFLAGLLIEINRFNPDLLVYP
3D structure
PDB7dr2 Structural insights into an evolutionary turning-point of photosystem I from prokaryotes to eukaryotes
ChaincJ
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA cJ A10 P11 A8 P9
BS02 CLA cJ L25 N29 L35 L23 N27 L33
BS03 CLA cJ F19 F20 E27 F31 F17 F18 E25 F29
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0009842 cyanelle
GO:0016020 membrane
GO:0033115 cyanelle thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dr2, PDBe:7dr2, PDBj:7dr2
PDBsum7dr2
PubMed
UniProtP48117|PSAJ_CYAPA Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]