Structure of PDB 7coy Chain cI

Receptor sequence

>7coycI (length=30) Species: 329726 (Acaryochloris marina MBIC11017)

SDILPAIMTPLVVLIGGGAAMTAFFYYVER

3D structure

• PDB: 7coy Structure of the far-red light utilizing photosystem I of Acaryochloris marina.
• Chain: cI
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	cI	S3 L6	S1 L4
BS02	CL7	cI	L6 P7 M10 T11	L4 P5 M8 T9
BS03	CL7	cI	V15 L16	V13 L14
BS04	CL7	cI	F27 E31	F25 E29

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 07:54:35 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7coy', asym_id = 'cI', title = 'Structure of the far-red light utilizing photosystem I of Acaryochloris marina.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7coy', asym_id='cI', title='Structure of the far-red light utilizing photosystem I of Acaryochloris marina.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009522,0015979', uniprot = '', pdbid = '7coy', asym_id = 'cI'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0015979', uniprot='', pdbid='7coy', asym_id='cI')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>