Structure of PDB 6jeo Chain cI

Receptor sequence
>6jeocI (length=31) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]
ASFLSSIFVPVIGWVVPIATFSFLFLYIERE
3D structure
PDB6jeo Structure of a cyanobacterial photosystem I tetramer revealed by cryo-electron microscopy.
ChaincI
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA cI S17 F20 I24 S5 F8 I12
BS02 CLA cI G25 W26 G13 W14
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jeo, PDBe:6jeo, PDBj:6jeo
PDBsum6jeo
PubMed31666526
UniProtP58560|PSAI_NOSS1 Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]