Structure of PDB 6kgx Chain c8

Receptor sequence

>6kgxc8 (length=177) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

PDB

6kgx Structural basis of energy transfer in Porphyridium purpureum phycobilisome.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	c8	N72 R77 R78 A81 C82 D85 L113 L120 V122 S127	N72 R77 R78 A81 C82 D85 L113 L120 V122 S127
BS02	PEB	c8	C50 D54 S57 G58 C61 I133 Q137 A146 T147 E148	C50 D54 S57 G58 C61 I133 Q137 A146 T147 E148
BS03	PEB	c8	N35 K36 L38 D39 I142 F153 A154 A155 C158	N35 K36 L38 D39 I142 F153 A154 A155 C158
BS04	PEB	c8	Y74 N76 M79	Y74 N76 M79

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6kgx, PDBe:6kgx, PDBj:6kgx
PDBsum	6kgx
PubMed	32076272
UniProt	P11393\|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]