Structure of PDB 5tga Chain c8

Receptor sequence

>5tgac8 (length=145) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKAD
VDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYHTL
ANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRA

3D structure

PDB

5tga Molecular insights into protein synthesis with proline residues.

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	c8	K27 Y30 K36 G37 G39 R40 R41 Y42 R57 W84 F85 N87 R88 Q89 L109 D112 H122 R123 R126 H127 L131 R132 V133 R134 G135 Q136 H137 T138 K139 T140 T141 G142 R143 R144	K26 Y29 K35 G36 G38 R39 R40 Y41 R56 W83 F84 N86 R87 Q88 L108 D111 H121 R122 R125 H126 L130 R131 V132 R133 G134 Q135 H136 T137 K138 T139 T140 G141 R142 R143
BS02	OHX	c8	G95 D97	G94 D96
BS03	MG	c8	T33 I35 V38	T32 I34 V37

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5tga, PDBe:5tga, PDBj:5tga
PDBsum	5tga
PubMed	27827794
UniProt	P0CX55\|RS18A_YEAST Small ribosomal subunit protein uS13A (Gene Name=RPS18A)