Structure of PDB 5tgm Chain c6

Receptor sequence

>5tgmc6 (length=142) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SAVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEP
LLLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQS
KNELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR

3D structure

PDB

5tgm Molecular insights into protein synthesis with proline residues.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c6	Q8 T9 F10 K12 K13 K14 S15 V19 H21 K26 L28 K30 R66 G71 G72 G73 H74 V75 S76 S121 R122 R123 P124 E125 P126 K127 K128 F129 K132 A134 R135 S136 R137 F138 Q139 K140 Y142 R143	Q7 T8 F9 K11 K12 K13 S14 V18 H20 K25 L27 K29 R65 G70 G71 G72 H73 V74 S75 S120 R121 R122 P123 E124 P125 K126 K127 F128 K131 A133 R134 S135 R136 F137 Q138 K139 Y141 R142
BS02	MG	c6	K127 K128	K126 K127

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation
GO:0006413	translational initiation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5tgm, PDBe:5tgm, PDBj:5tgm
PDBsum	5tgm
PubMed	27827794
UniProt	P0CX51\|RS16A_YEAST Small ribosomal subunit protein uS9A (Gene Name=RPS16A)