Structure of PDB 5on6 Chain c5

Receptor sequence

>5on6c5 (length=135) Species: 559292 (Saccharomyces cerevisiae S288C)

AVNAKKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKP
AGFMKKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFN
QVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRF

3D structure

• PDB: 5on6 The Amaryllidaceae Alkaloid Haemanthamine Binds the Eukaryotic Ribosome to Repress Cancer Cell Growth.
• Chain: c5
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c5	R18 P38 A39 R40 R42 R43 R44 R47 R77 H79 R81 N82 Y97 G99 K100 Y115 G117 E118 I121 T122 Y123 T124 V126 H128 T135 S136 R137 F138	R15 P35 A36 R37 R39 R40 R41 R44 R74 H76 R78 N79 Y94 G96 K97 Y112 G114 E115 I118 T119 Y120 T121 V123 H125 T132 S133 R134 F135
BS02	OHX	c5	L65 A67 P68	L62 A64 P65

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0000054 ribosomal subunit export from nucleus
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5on6, PDBe:5on6, PDBj:5on6
• PDBsum: 5on6
• PubMed: 29429877
• UniProt: Q01855|RS15_YEAST Small ribosomal subunit protein uS19 (Gene Name=RPS15)