Structure of PDB 4u51 Chain c5

Receptor sequence

>4u51c5 (length=135) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

AVNAKKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKP
AGFMKKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFN
QVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRF

3D structure

PDB

4u51 ?

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c5	R18 P38 A39 R40 R42 R43 R44 R47 K59 R77 H79 R81 N82 Y97 N98 G99 K100 Y115 E118 I121 T122 Y123 T124 V126 H128 S136 R137 F138	R15 P35 A36 R37 R39 R40 R41 R44 K56 R74 H76 R78 N79 Y94 N95 G96 K97 Y112 E115 I118 T119 Y120 T121 V123 H125 S133 R134 F135
BS02	OHX	c5	L65 A67 P68	L62 A64 P65

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000054	ribosomal subunit export from nucleus
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u51, PDBe:4u51, PDBj:4u51
PDBsum	4u51
PubMed	25209664
UniProt	Q01855\|RS15_YEAST Small ribosomal subunit protein uS19 (Gene Name=RPS15)