Structure of PDB 5on6 Chain c4

Receptor sequence
>5on6c4 (length=128) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
NSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYA
AMLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSG
LRIGRIEDVTPVPSDSTRKKGGRRGRRL
3D structure
PDB5on6 The Amaryllidaceae Alkaloid Haemanthamine Binds the Eukaryotic Ribosome to Repress Cancer Cell Growth.
Chainc4
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5on6, PDBe:5on6, PDBj:5on6
PDBsum5on6
PubMed29429877
UniProtP39516|RS14B_YEAST Small ribosomal subunit protein uS11B (Gene Name=RPS14B)

[Back to BioLiP]