Structure of PDB 5dgf Chain c4

Receptor sequence

>5dgfc4 (length=128) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

NSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYA
AMLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSG
LRIGRIEDVTPVPSDSTRKKGGRRGRRL

3D structure

PDB

5dgf Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c4	N24 D25 F27 H29 G35 K36 E37 T38 R41 T43 G45 M46 D51 R52 E54 G88 V121 P122 S123 D124 S125 T126 R127 K129 G131 R132 R133 R135 R136 L137	N15 D16 F18 H20 G26 K27 E28 T29 R32 T34 G36 M37 D42 R43 E45 G79 V112 P113 S114 D115 S116 T117 R118 K120 G122 R123 R124 R126 R127 L128

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5dgf, PDBe:5dgf, PDBj:5dgf
PDBsum	5dgf
PubMed
UniProt	P06367\|RS14A_YEAST Small ribosomal subunit protein uS11A (Gene Name=RPS14A)