Structure of PDB 7r81 Chain c2

Receptor sequence
>7r81c2 (length=81) Species: 5141 (Neurospora crassa) [Search protein sequence]
VLAVDLLNPSPASEARKHKLKTLVPAPRSFFMDVKCPGCFTITTVFSHAQ
TVVICQGCTTVLCQPTGGKARLTEGCSFRRK
3D structure
PDB7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
Chainc2
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c2 R17 H19 K20 L21 K22 P28 S30 F47 Q51 P66 T67 G68 K70 R72 E75 R16 H18 K19 L20 K21 P27 S29 F46 Q50 P65 T66 G67 K69 R71 E74
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum7r81
PubMed34815343
UniProtQ7RVN2|RS27_NEUCR Small ribosomal subunit protein eS27 (Gene Name=crp-6)

[Back to BioLiP]