Structure of PDB 7ls1 Chain c2

Receptor sequence
>7ls1c2 (length=102) Species: 10090 (Mus musculus) [Search protein sequence]
ALRYPMAVGLNKGHKVTKNVSKPRHSRRRSRLTNHTKFVRDMIREVCGFA
PYERRAMELLKVSKSKRALKFIKKRVGTHIRAKRKREELSNVLAAMEEAA
AK
3D structure
PDB7ls1 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
Chainc2
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c2 R4 G14 H15 R25 H26 S27 R28 R29 R30 S31 R32 L33 T34 H36 R41 Y53 K67 R68 K75 R76 G78 H80 R82 R85 K86 R3 G13 H14 R24 H25 S26 R27 R28 R29 S30 R31 L32 T33 H35 R40 Y52 K66 R67 K74 R75 G77 H79 R81 R84 K85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0140236 translation at presynapse
GO:0140242 translation at postsynapse
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ls1, PDBe:7ls1, PDBj:7ls1
PDBsum7ls1
PubMed34815424
UniProtP47964|RL36_MOUSE Large ribosomal subunit protein eL36 (Gene Name=Rpl36)

[Back to BioLiP]