Structure of PDB 6qc3 Chain c1

Receptor sequence
>6qc3c1 (length=239) Species: 9940 (Ovis aries) [Search protein sequence]
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRH
LVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEA
ARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPRVSLREGLYFNP
YFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHR
KRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
3D structure
PDB6qc3 Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.
Chainc1
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC c1 V36 C37 C40 H41 N105 P110 R120 L130 F152 G158 M159 P162 V36 C37 C40 H41 N105 P110 R120 L130 F152 G158 M159 P162
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 10:28:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6qc3', asym_id = 'c1', title = 'Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6qc3', asym_id='c1', title='Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009055,0020037', uniprot = '', pdbid = '6qc3', asym_id = 'c1'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009055,0020037', uniprot='', pdbid='6qc3', asym_id='c1')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>