Structure of PDB 5obm Chain c1

Receptor sequence

>5obmc1 (length=142) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

TVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYID
KKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHK
NVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAG

3D structure

PDB

5obm Aminoglycoside interactions and impacts on the eukaryotic ribosome.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c1	E10 A12 Q14 P17 H18 F20 K26 T27 S28 K29 W34 K36 N37 A38 G39 L40 K46 E50 K57 S65 I66 R67 G68 K69 K79 M80 H81 T83 Y90 H92 K96 R99 K102 R103 H104 K105 N106 Q127 R129 P130 I131 S132 K133 T134 R136 F137	E5 A7 Q9 P12 H13 F15 K21 T22 S23 K24 W29 K31 N32 A33 G34 L35 K41 E45 K52 S60 I61 R62 G63 K64 K74 M75 H76 T78 Y85 H87 K91 R94 K97 R98 H99 K100 N101 Q122 R124 P125 I126 S127 K128 T129 R131 F132

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5obm, PDBe:5obm, PDBj:5obm
PDBsum	5obm
PubMed	29208708
UniProt	P0CX47\|RS11A_YEAST Small ribosomal subunit protein uS17A (Gene Name=RPS11A)