Structure of PDB 8s8h Chain c |
>8s8hc (length=64) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] |
KTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTTRTIVRNVKGPVREGDI LVLMESEREARRLR |
|
PDB | 8s8h Structural basis of AUC codon discrimination during translation initiation in yeast. |
Chain | c |
Resolution | 4.0 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
c |
R18 R22 G23 P47 |
R15 R19 G20 P44 |
|
|
|