Structure of PDB 8ovj Chain c

Receptor sequence

>8ovjc (length=229) Species: 347515 (Leishmania major strain Friedlin)

KRAAFKQQQTESFKKAVVARKAAKAALKKTAYLRARKYSREYRGAEKKLV
TLRRQAASHGNYYLEAKPKVAVVTRIRGIAKVNPKQRKILQLLRLRQIFN
TVFVKMNKPMENMLRAVEPYIAYGYPSLATVRAMVYKRGYLKINGQRVKI
TDNQMIKDKYNNVDIVCAEDMVNQIYTCGKHFRTVTHGMWPFKLAPPAGG
MRQKRRHFVEGGDYGNRDTLINRFLARMI

3D structure

• PDB: 8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Chain: c
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	R25 F28 A39 V40 R43 K44 Y55 R59 R66 G67 K70 T74 R77 Q78 H82 R100 G101 K104 N106 P107 K111 I112 L115 R117 R119 Q120 N130 K131 P132 N135 S150 A152 R161 Q169 R170 R206 H210 K216 L217 P219 A221 G222 G223 M224 K227 T242 R246 R250	R2 F5 A16 V17 R20 K21 Y32 R36 R43 G44 K47 T51 R54 Q55 H59 R77 G78 K81 N83 P84 K88 I89 L92 R94 R96 Q97 N107 K108 P109 N112 S127 A129 R138 Q146 R147 R183 H187 K193 L194 P196 A198 G199 G200 M201 K204 T219 R223 R227
BS02	rna	c	R138 E141 R228 H230 E233	R115 E118 R205 H207 E210

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit

External links

• PDB: RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
• PDBsum: 8ovj
• PubMed: 38722744
• UniProt: Q4Q9H4