Structure of PDB 8jzf Chain c

Receptor sequence

>8jzfc (length=86) Species: 2949 (Symbiodinium)

SHAVKIYDTCIGCTLCVRACPTDVLEMVPASINAAKQVASSPRVEDCVGC
KRCETACPTDFLSIRVYLQDNEETQYSLGLDLVDWS

3D structure

• PDB: 8jzf Structures and organizations of PSI-AcpPCI supercomplexes from red tidal and coral symbiotic photosynthetic dinoflagellates.
• Chain: c
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	c	C103 P104 V107 C130 V131 G132 C133 K134 C136 V149	C20 P21 V24 C47 V48 G49 C50 K51 C53 V66
BS02	SF4	c	C93 I94 G95 C96 T97 C99 A122 C140 P141 I147	C10 I11 G12 C13 T14 C16 A39 C57 P58 I64

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0015979 photosynthesis

Cellular Component

• GO:0009522 photosystem I
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:8jzf, PDBe:8jzf, PDBj:8jzf
• PDBsum: 8jzf
• PubMed: 38319970
• UniProt: A0A812FX01