Structure of PDB 8jjr Chain c

Receptor sequence
>8jjrc (length=86) Species: 2950 (Symbiodinium sp.) [Search protein sequence]
SHAVKIYDTCIGCTLCVRACPTDVLEMVPATVNAAKQVASSPRVEDCVGC
KRCETACPTDFLSIRVYLQENEETQYSLGLDLADWS
3D structure
PDB8jjr Architecture of symbiotic dinoflagellate photosystem I-light-harvesting supercomplex in Symbiodinium.
Chainc
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 SF4 c C95 P96 V99 C122 V123 G124 C125 K126 C128 V141 C20 P21 V24 C47 V48 G49 C50 K51 C53 V66
BS02 SF4 c C85 I86 G87 C88 C91 A114 C132 P133 S138 I139 C10 I11 G12 C13 C16 A39 C57 P58 S63 I64
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Tue Dec 3 03:08:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jjr', asym_id = 'c', title = 'Architecture of symbiotic dinoflagellate photosy... I-light-harvesting supercomplex in Symbiodinium.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jjr', asym_id='c', title='Architecture of symbiotic dinoflagellate photosy... I-light-harvesting supercomplex in Symbiodinium.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009055,0009522,0009773,0015979,0042651,0051539', uniprot = '', pdbid = '8jjr', asym_id = 'c'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009055,0009522,0009773,0015979,0042651,0051539', uniprot='', pdbid='8jjr', asym_id='c')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>