Structure of PDB 8i7j Chain c |
>8i7jc (length=63) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] |
TPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTTRTIVRNVKGPVREGDIL VLMESEREARRLR |
|
PDB | 8i7j Yeast eukaryotic initiation factor 4B remodels the mRNA entry site on the small ribosomal subunit |
Chain | c |
Resolution | 4.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
c |
K14 P47 R49 |
K10 P43 R45 |
|
|
|
|