Structure of PDB 8i0s Chain c

Receptor sequence

>8i0sc (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]

EEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLEN
VKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIA

3D structure

PDB

8i0s Molecular Basis for the Activation of Human Spliceosome

Chain

Resolution

4.2 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	E20 G103 D104 V106	E1 G84 D85 V87

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000387	spliceosomal snRNP assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0036261	7-methylguanosine cap hypermethylation
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0005684	U2-type spliceosomal complex
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0005687	U4 snRNP
GO:0005689	U12-type spliceosomal complex
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0030532	small nuclear ribonucleoprotein complex
GO:0034709	methylosome
GO:0034715	pICln-Sm protein complex
GO:0034719	SMN-Sm protein complex
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0070062	extracellular exosome
GO:0071005	U2-type precatalytic spliceosome
GO:0071007	U2-type catalytic step 2 spliceosome
GO:0071011	precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome

External links

PDB	RCSB:8i0s, PDBe:8i0s, PDBj:8i0s
PDBsum	8i0s
PubMed	39068178
UniProt	P62316\|SMD2_HUMAN Small nuclear ribonucleoprotein Sm D2 (Gene Name=SNRPD2)