Structure of PDB 8gn0 Chain c

Receptor sequence

>8gn0c (length=455) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]

NSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMT
LFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVH
LISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVL
GIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPF
GGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSG
EAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFL
IRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEP
LRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVN
FVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLS
MPSLD

3D structure

PDB

8gn0 Structural insights into the action mechanisms of artificial electron acceptors in photosystem II.

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	OEX	c	E354 R357	E336 R339
BS02	CA	c	F22 T24 D27 E29 S30	F4 T6 D9 E11 S12
BS03	CLA	c	L168 G171 A172 L175 H237 I240 M282 I285 F289 V296 Y297	L150 G153 A154 L157 H219 I222 M264 I267 F271 V278 Y279
BS04	CLA	c	W63 H91 L279 M282 A286 V290 Y297 H430 L433 F437	W45 H73 L261 M264 A268 V272 Y279 H412 L415 F419
BS05	CLA	c	I60 V61 H91 V114 H118	I42 V43 H73 V96 H100
BS06	CLA	c	W63 M67 F70 G85 I87 W425 S429 F436	W45 M49 F52 G67 I69 W407 S411 F418
BS07	CLA	c	Y274 G277 M281 H441 L442 A445 R449	Y256 G259 M263 H423 L424 A427 R431
BS08	CLA	c	L161 L165 L213 I243 G247 W250 H251 T255 P256 F257 W259 F264	L143 L147 L195 I225 G229 W232 H233 T237 P238 F239 W241 F246
BS09	CLA	c	M157 L161 H164 L168 F264 W266 Y271 Y274 S275	M139 L143 H146 L150 F246 W248 Y253 Y256 S257
BS10	CLA	c	W36 A37 N39 L272 L276 F436 F437 G440 W443 H444 R447	W18 A19 N21 L254 L258 F418 F419 G422 W425 H426 R429
BS11	CLA	c	N39 L49 A52 H53 H56 Y149 W151 G268 E269 Y271 L272 S275	N21 L31 A34 H35 H38 Y131 W133 G250 E251 Y253 L254 S257
BS12	CLA	c	H56 L59 I60 W63 F437	H38 L41 I42 W45 F419
BS13	CLA	c	R26 W35 G38 N39 R41 L42 K48 A52 F127	R8 W17 G20 N21 R23 L24 K30 A34 F109
BS14	CLA	c	H53 F147 F163 H164 I166 V167	H35 F129 F145 H146 I148 V149
BS15	CLA	c	L50 V124 G128 Y131 H132 Y143 F147	L32 V106 G110 Y113 H114 Y125 F129

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009767	photosynthetic electron transport chain
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005737	cytoplasm
GO:0009521	photosystem
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8gn0, PDBe:8gn0, PDBj:8gn0
PDBsum	8gn0
PubMed	37209822
UniProt	D0VWR7\|PSBC_THEVL Photosystem II CP43 reaction center protein (Fragment) (Gene Name=psbC)

[Back to BioLiP]