Structure of PDB 8f1f Chain c |
>8f1fc (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] |
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGRQL EDGRTLSDYNIQKESTLHLVLRLRGG |
|
PDB | 8f1f Mechanism of selective recognition of Lys48-linked polyubiquitin by macrocyclic peptide inhibitors of proteasomal degradation |
Chain | c |
Resolution | 1.85 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
c |
V70 L71 L73 |
V70 L71 L73 |
|
|
|