Structure of PDB 8eug Chain c

Receptor sequence
>8eugc (length=95) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
DTINSKLALTMKSGKYVLGYKSTLKTLRSGKAKLILIAANAPPLRKSELE
YYAMLSRCSVHHYSGNNIDLGTACGKLFRVGVLAVIDAGDSDILA
3D structure
PDB8eug Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Chainc
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c L39 G40 Y41 K42 S43 P63 P64 R66 K67 S68 E71 L98 F99 V101 G102 L18 G19 Y20 K21 S22 P42 P43 R45 K46 S47 E50 L77 F78 V80 G81
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eug, PDBe:8eug, PDBj:8eug
PDBsum8eug
PubMed36423630
UniProtQ9UTP0|RL30B_SCHPO Large ribosomal subunit protein eL30B (Gene Name=rpl3002)

[Back to BioLiP]