Structure of PDB 8crx Chain c

Receptor sequence

>8crxc (length=274) Species: 1747 (Cutibacterium acnes) [Search protein sequence]

GIRKYKPTTPGRRGSSVSDFVELTRSTPEKSLLVAKPKTGGRNNTGRITT
RHIGGGHKQAYRIIDFKRYDKDGVPAKVAHIEYDPNRTARIALLHYADGE
KRYIIAPDGVGQGTVVVSGPEADIKPGNNLPLRNIPVGTTVHAVELRPGG
GAKMGRSAGASVQLVAREGKYATVRLPSGEMRMVDIRCRATIGEVGNAEQ
ININWGKAGRNRWKGIRPTVRGVVMNPIDHPHGGGEGRTSGGRHPVSPWG
KPEGRTRNKKKASSRLIVRRRKSG

3D structure

PDB

8crx Sarecycline inhibits protein translation in Cutibacterium acnes 70S ribosome using a two-site mechanism.

Chain

Resolution

2.78 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	R4 K7 P8 T9 T10 P11 R13 R14 F21 K31 P38 K39 T40 G42 R43 N44 N45 T46 G47 R48 I49 T50 T51 R52 G56 H58 K59 Q60 A61 Y62 R63 V75 Y84 P86 R88 T89 D99 G100 E101 K102 L147 R148 G150 G151 K154 M155 G156 R157 S158 A159 Y172 L177 P178 S179 E181 R183 R188 A199 Q201 I202 N205 W206 G207 K208 A209 G210 R211 N212 R213 W214 R218 P219 T220 V221 R222 G223 V224 V225 M226 N227 I229 D230 H231 H233 G235 G236 E237 G238 R239 T240 S241 G243 R244 H245 P246 P249 W250 E254 R256 T257 R258 R266 R270 R271 S274	R3 K6 P7 T8 T9 P10 R12 R13 F20 K30 P37 K38 T39 G41 R42 N43 N44 T45 G46 R47 I48 T49 T50 R51 G55 H57 K58 Q59 A60 Y61 R62 V74 Y83 P85 R87 T88 D98 G99 E100 K101 L146 R147 G149 G150 K153 M154 G155 R156 S157 A158 Y171 L176 P177 S178 E180 R182 R187 A198 Q200 I201 N204 W205 G206 K207 A208 G209 R210 N211 R212 W213 R217 P218 T219 V220 R221 G222 V223 V224 M225 N226 I228 D229 H230 H232 G234 G235 E236 G237 R238 T239 S240 G242 R243 H244 P245 P248 W249 E253 R255 T256 R257 R265 R269 R270 S273
BS02	MG	c	H233 G234 G242	H232 G233 G241

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8crx, PDBe:8crx, PDBj:8crx
PDBsum	8crx
PubMed	36864821
UniProt	A0A2B7JMV5

[Back to BioLiP]