Structure of PDB 8azw Chain c

Receptor sequence

>8azwc (length=233) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

NPLFEKRPKQFGIGGALPPKKDLTRFVRWPQVVRIQRKRRILKQRLKVPP
SLNQFSKTLDKNLATNLFKMLLKYRPEDKAAKKERLLKRAQAEAEGKTPE
TKKPIIVKYGLKHITYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEI
PYCIVKGKARLGSIVHKKTASALCLTTVKNEDKMEFSRILEAIKANFNDK
YEENRKKWGGGVMGSKSQARTKAKERVLAKEAA

3D structure

PDB

8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.14 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	E26 R28 K30 Q31 F32 G33 I34 L38 P40 K41 R46 F47 R49 P51 Q52 V53 R61 R66 K68 E98 K103 K104 R106 T122 K124 P125 K129 Y130 G131 L132 K133 H134 Y137 V153 D154 L158 K179 A180 K189 T190 S192 M234 G235 S236 K237 S238	E5 R7 K9 Q10 F11 G12 I13 L17 P19 K20 R25 F26 R28 P30 Q31 V32 R40 R45 K47 E77 K82 K83 R85 T101 K103 P104 K108 Y109 G110 L111 K112 H113 Y116 V132 D133 L137 K158 A159 K168 T169 S171 M213 G214 S215 K216 S217
BS02	rna	c	V54 Q57 R58 R61 K82 H151 D152 K177	V33 Q36 R37 R40 K61 H130 D131 K156

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8azw, PDBe:8azw, PDBj:8azw
PDBsum	8azw
PubMed	37156858
UniProt	A0A1S4D668

[Back to BioLiP]