Structure of PDB 8asl Chain c

Receptor sequence

>8aslc (length=80) Species: 1148 (Synechocystis sp. PCC 6803)

SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGC
KRCETACPTDFLSIRVYLGAETTRSMGLAY

3D structure

• PDB: 8asl The Ycf48 accessory factor occupies the site of the oxygen-evolving manganese cluster during photosystem II biogenesis.
• Chain: c
• Resolution: 3.15 Å

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	c	C21 P22 C48 V49 G50 C51 K52 C54 V67	C20 P21 C47 V48 G49 C50 K51 C53 V66
BS02	SF4	c	C11 I12 G13 C14 T15 C17 C58 P59 I65	C10 I11 G12 C13 T14 C16 C57 P58 I64

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0015979 photosynthesis

Cellular Component

• GO:0009522 photosystem I
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:8asl, PDBe:8asl, PDBj:8asl
• PDBsum: 8asl
• PubMed: 37542031
• UniProt: P32422|PSAC_SYNY3 Photosystem I iron-sulfur center (Gene Name=psaC)